Gene Rv3712
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible ligase |
| Comments | Rv3712, (MTV025.060), len: 413 aa. Possible ligase , equivalent to O69522|ML2326|MLCB2407.24c hypothetical 43.8 KDA protein (possible ligase) from Mycobacterium leprae (411 aa), FASTA scores: opt: 2265, E(): 8e-129, (84.25% identity in 413 aa overlap). Also similar to ligases or hypothetical proteins e.g. Q9FCA1|2SCG58.12 putative ligase from Streptomyces coelicolor (412 aa), FASTA scores: opt: 1168, E(): 6.7e-63, (45.8% identity in 406 aa overlap); P74303|SLR0938 hypothetical 50.2 KDA protein from Synechocystis sp. strain PCC 6803 (459 aa), FASTA scores: opt: 392, E(): 3.1e-16, (28.45% identity in 397 aa overlap); Q99ZX1|SPY1035 putative UDP-N-acetylmuramyl tripeptide synthetase from Streptococcus pyogenes (445 aa), FASTA scores: opt: 335, E(): 8.1e-13, (29.2% identity in 438 aa overlap); Q9CGJ0|YLBD hypothetical protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (449 aa), FASTA scores: opt: 324, E(): 3.8e-12, (28.75% identity in 445 aa overlap); Q9ZGG7|MURC UDP-N-acetylmuramyl tripeptide synthetase from Heliobacillus mobilis (455 aa), FASTA scores: opt: 292, E(): 3.2e-10, (30.75% identity in 449 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4156981 | 4158222 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3712|Rv3712
VVTTRARLALAAGAGARWASRVTGRGAGAMIGGLVAMTLDRSILRQLGMGRRTVVVTGTNGKSTTTRMTAAALGTLGAVATNAEGANMDAGLVAALAAHRDAELAVLEVDEMHVPHISDAVDPAVVVLLNLSRDQLDRVGEINVIERTLRAGLARHPDAVVVANCDDVLMTSAAYDSPNVVWVAAGGAWSNDSVSCPRSGEVIVRKAPSQEDHWYSTGADFKRPAPHWWFDDATLYGPDGLALPMRLALPGSVNRGNAAQAVAAAVALGADPAVAVAAVCQVDEVAGRYRTVRIGAHQARILLAKNPAGWQEALAMVDKHADGVVIAVNGRVPDGEDLSWLWDVRFEHFEKTRVVAAGERGTDLAVRLGYAGVEHTLVHDTVAAIASCPPGRVEVVANYTAFLQLQRALARRG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
