Gene MMAR_5353
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | Unknown |
| Product | short-chain type dehydrogenase/reductase |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6465089 | 6465853 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5353|MMAR_5353
MVLDAVGNPQSVLLLGGTSEIGLAICQRYLRNAPARIVLACLPDDPGRDDAVAQMKAAGASSVELIDFDAMDTDSHPKVIEQAFGGGDVDVAIVAFGLLGDAEELWQNQHKAVQIAEINYTAAVSVGVLLGEKMRAQGFGQIIAMSTVAGERVRRSNFVYGSTKAGLDGFYLGLSEALREHGVRVLVIRPGQVRTRMSAHVKEAPLTVDKEYVANLAVTAAAKGKELVWAPAAFRYVMMVLRHIPRSIFRRLPI
Bibliography
No article yet recorded