Gene MMAR_5569
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'terminus. it can also cleave other RNA substrates such as 4.5S RNA. the protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme [catalytic activity: endonucleolytic cleavage of RNA, removing 5'-extra-nucleotide from tRNA precursor]. |
| Product | ribonuclease P protein component RnpA |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6635767 | 6636129 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5569|rnpA
VLSARNRMRRSTEFDATVRQGVRTVQPDVIVHVRRAKECAADSSPRVGLIIAKSVGTAVERHRVARRLRHVARPMLMNLHPCDRVVIRALPSSRHVSSAWLEQQLRSGLRRAFESAGADR
Bibliography
No article yet recorded