Gene Rv3923c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | RNaseP catalyzes the removal of the 5'-leader sequence from PRE-tRNA to produce the mature 5'terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme [catalytic activity: endonucleolytic cleavage of RNA, removing 5'-extra-nucleotide from tRNA precursor]. |
| Product | Ribonuclease P protein component RnpA (RNaseP protein) (RNase P protein) (protein C5) |
| Comments | Rv3923c, (MT4041, MTV028.14c), len: 125 aa. RnpA, ribonuclease P protein component (see citations below), equivalent, but longer ~10 aa, to P46610|RNPA_MYCLE|ML2712 ribonuclease P protein component from Mycobacterium leprae (120 aa), FASTA scores: opt: 456, E(): 3.3e-24, (63.0% identity in 119 aa overlap); and Q9L7L9|RNPA from Mycobacterium paratuberculosis (119 aa), FASTA scores: opt: 426, E(): 3.5e-22, (60.65% identity in 122 aa overlap). Also similar to many e.g. P25817|RNPA_STRBI from Streptomyces bikiniensis (123 aa), FASTA scores: opt: 174, E(): 4.2e-05, (36.8% identity in 125 aa overlap); P25814|RNPA_BACSU from Bacillus subtilis (116 aa) FASTA scores: opt: 168, E(): 0.0001, (26.85% identity in 108 aa overlap); P48206|RNPA_STRCO|STH24.03 from Streptomyces coelicolor (123 aa), FASTA scores: opt: 166, E(): 0.00015, (37.6% identity in 125 aa overlap); etc. Contains PS00648 Bacterial Ribonuclease P protein component signature. Belongs to the RnpA family. |
| Functional category | Information pathways |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4410412 | 4410789 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3923c|rnpA
LIATPGLFAVLRARNRMRRSADFETTVKHGMRTVRSDMVVYWWRGSGGGPRVGLIIAKSVGSAVERHRVARRLRHVAGSIVKELHPSDHVVIRALPSSRHVSSARLEQQLRCGLRRAVELAGSDR
Bibliography
- Fsihi H et al. [1996]. Gene arrangement and organization in a approximately 76 kb fragment encompassing the oriC region of the chromosome of Mycobacterium leprae. Homolog Secondary
- Salazar L et al. [1996]. Organization of the origins of replication of the chromosomes of Mycobacterium smegmatis, Mycobacterium leprae and Mycobacterium tuberculosis and isolation of a functional origin from M. smegmatis. Sequence
- Qin MH, Madiraju MV and Rajagopalan M [1999]. Characterization of the functional replication origin of Mycobacterium tuberculosis. Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
