Gene MSMEG_3456
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hydroxylaminobenzene mutase |
| Comments | - |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3521554 | 3521997 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_3456|MSMEG_3456
METADRKLIRHGAFLFLIGLVTGLQERRFTNMRMALSAHLEGVMNGTFLIALGAVWGQVALPPPLARIARWTALYGTYGNWLFTALGAAMGTAAANPILPQGHRGKPWQERLAGTGFRSIAYAILVSVVLIVIGLRNPRKLGAECGS
Bibliography
No article yet recorded