Gene Rv3078
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Enzyme involved in the second step of nitrobenzene degradation: rearranged the intermediate hydroxylaminobenzene to 2-aminophenol. |
| Product | Probable hydroxylaminobenzene mutase Hab |
| Comments | Rv3078, (MTCY22D7.03c), len: 133 aa. Probable hab, hydroxylaminobenzene mutase (5.-.-.-) (see Davis et al., 2000), highly similar to two hydroxylaminobenzene mutases from Pseudomonas pseudoalcaligenes O52214|HABA (135 aa), FASTA scores: opt: 495, E(): 6.8e-25, (51.1% identity in 133 aa overlap); and O52216|HABB (164 aa), FASTA scores: opt: 479, E(): 8.2e-24, (51.9% identity in 133 aa overlap) (see Davis et al., 2000); and to Q9AH35|NBZB hydroxylaminobenzene mutase from Pseudomonas putida (164 aa), FASTA scores: opt: 476, E(): 1.3e-23, (51.8% identity in 133 aa overlap) (see Park & Kim 2000). Gene name according to Pseudomonas pseudoalcaligenes nomenclature. Also similarity with putative different membrane proteins involved in transport (protein predicted to be a transmembrane protein). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3441353 | 3441754 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3078|hab
LQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPEAWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHKAPAAKEGFVSFLLLSLSVAIVIGVVIVIIGL
Bibliography
- Park HS et al. [2000]. Identification and characterization of the nitrobenzene catabolic plasmids pNB1 and pNB2 in Pseudomonas putida HS12. Homolog Sequence Function
- Davis JK et al. [2000]. Sequence analysis and initial characterization of two isozymes of hydroxylaminobenzene mutase from Pseudomonas pseudoalcaligenes JS45. Homolog Sequence Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
