Gene MSMEG_3628
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ComA operon protein 2 |
| Comments | identified by match to protein family HMM PF03061; match to protein family HMM TIGR00369 |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3689837 | 3690232 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_3628|MSMEG_3628
MNAGIGKGFDSEIGLNYTELGPDGGRAELKITEKLLQPWGIVHGGVYCSIVESLASVSGHIWLSENGGGTVVGVNNNTDFLRAIGSGTVTAVSTPIHRGRRQQLWLITLTDEDGRTVARGQVRLQNMPAES
Bibliography
No article yet recorded