Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1847, (MTCY359.26c), len: 140 aa. Conserved protein, possible thioesterase, some similarity to YBDB proteins of Escherichia coli and H. influenzae e.g. P15050|YBDB_ECOLI hypothetical 15.0 KD protein in ENTA-CSTA intergenic region (137 aa), FASTA scores: opt: 232, E(): 6.6e-10, (35.8% identity in 106 aa overlap); C48956|G142208 thioesterase from Arthrobacter sp (151 aa), FASTA score: opt: 254, E(): 1.7e-11, (33.3% identity in 138 aa overlap). Also similar to AF064959|AF064959_1 hypothetical protein from Coxiella burnetii (148 aa), FASTA score: opt: 264, E(): 9.3e- 12, (36.8% identity in 117 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20968772097299+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1847|Rv1847
VQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAAFAWLNSHGEGGSVVGVNNNTDFVRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDRVVARGQVRLQNLEARP