Gene MT18B_1349
in Mycobacterium tuberculosis 18b
General annotation
Type | CDS |
Function | Unknown |
Product | putative membrane protein KdpF |
Comments | - |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1149750 | 1149842 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis 18b|MT18B_1349|kdpF MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Bibliography
- Benjak A et al. [2016]. Genomic and transcriptomic analysis of the streptomycin-dependent Mycobacterium tuberculosis strain 18b. Sequence