Gene Rv1028A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in stabilization of the KDP complex. |
| Product | Probable membrane protein KdpF |
| Comments | Rv1028A, len: 30 aa. Probable kdpF, membrane protein, showing similarity with P36937|KDPF_ECOLI|B0698.1 protein KDPF from Escherichia coli strain K12 (see citation below) (27% identity); and KdpF protein from Streptomyces coelicolor (51% identity). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1151920 | 1152012 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1028A|kdpF
MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Bibliography
- Gassel M et al. [2001]. Analysis of KdpC of the K(+)-transporting KdpFABC complex of Escherichia coli. Homolog Function
- Li C et al. [2007]. Uniformly aligned full-length membrane proteins in liquid crystalline bilayers for structural characterization. Structure
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
