Gene MT18B_5272
in Mycobacterium tuberculosis 18b
General annotation
Type | CDS |
Function | Unknown |
Product | 50S ribosomal protein L36 RpmJ |
Comments | - |
Functional category | Information pathways |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3881467 | 3881580 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis 18b|MT18B_5272|rpmJ MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
Bibliography
- Benjak A et al. [2016]. Genomic and transcriptomic analysis of the streptomycin-dependent Mycobacterium tuberculosis strain 18b. Sequence