Gene Rv3461c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism. |
| Product | 50S ribosomal protein L36 RpmJ |
| Comments | Rv3461c, (MTCY13E12.14c), len: 37 aa. rpmJ, 50S ribosomal protein L36, equivalent to P45810|RL36_MYCBO|RPMJ from Mycobacterium bovis (37 aa); and Q9X7A2|RL36_MYCLE|RPMJ|ML1961|MLCB1222.31c 50S ribosomal protein L36 from Mycobacterium leprae (37 aa), FASTA scores: opt: 241, E(): 9.7e-14, (86.5% identity in 37 aa overlap). Also highly similar to others e.g. O86772|RL36_STRCO|SC6G4.04 from Streptomyces coelicolor (37 aa), FASTA scores: opt: 233, E(): 4.5e-13, (83.8% identity in 37 aa overlap); P07841|RL36_BACST|RPMJ from Bacillus stearothermophilus (37 aa), FASTA scores: opt: 214, E(): 1.6e-11, (72.95% identity in 37 aa overlap); P12230|RK36_SPIOL|RPL36 from Spinacia oleracea (Spinach) (37 aa), FASTA scores: opt: 211, E(): 2.9e-11, (70.25% identity in 37 aa overlap); etc. Contains PS00828 Ribosomal protein L36 signature. Belongs to the L36P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3880286 | 3880399 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3461c|rpmJ
VKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
