Gene Mb0019c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein with fha domain, fhab |
| Comments | Mb0019c, -, len: 155 aa. Equivalent to Rv0019c,len: 155 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 155 aa overlap). Conserved hypothetical protein, equivalent to MLCB1770_14|NP_301147.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (155 aa), FASTA scores: opt: 902, E(): 0, (91.0% identity in 155 aa overlap). Also highly similar to T36713|AL079308|SCH69_14 from Streptomyces coelicolor (172 aa), FASTA scores: opt: 389,E(): 6e-21, (46.2% identity in 171 aa overlap); and similar in C-terminus to others e.g. NP_342559.1|NC_002754 Conserved hypothetical protein from Sulfolobus solfataricus (209 aa); etc. C-terminus also highly similar to C-terminal part of AAF07901.1|AF173844_2|AF173844 putative signal transduction protein GarA from Mycobacterium smegmatis (158 aa). Also similar to Rv1827|MTCY 1A11.16c from Mycobacterium tuberculosis ( 162 aa), FASTA score: (41.2% identity in 85 aa overlap); MTMOAIS_3; MAU66560_1 and MLCB1788_15. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 23269 | 23736 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0019c|fhab
MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP
Bibliography
No article yet recorded
