Gene Mb0039
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0039, -, len: 202 aa. Equivalent to Rv0038, len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 202 aa overlap). Conserved hypothetical protein, equivalent to MLCB1770_16|Q50191|Y038_MYCLE hypothetical 22.0 kDa from Mycobacterium leprae (202 aa), FASTA scores: opt: 1194,E(): 0, (88.6% identity in 202 aa overlap). Also highly similar or similar to other hypothetical proteins e.g. CAB72194.1|AL138851|SCE59.07c from Streptomyces coelicolor (193 aa); AAC06288.1|AF050466 from Mycobacterium bovis (82 aa) (similarity in N-terminus); NP_224347.1|NC_000922|YqgE from Chlamydophila pneumoniae (188 aa); YQGE_ECOLI HYPOTHETICAL 20.7 KD PROTEIN (187 aa), FASTA score: (29.5% identity in 166 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 41288 | 41896 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0039|Mb0039
MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADPEGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLSALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN
Bibliography
No article yet recorded