Gene Mb0053
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0053, -, len: 187 aa. Equivalent to Rv0052, len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 187 aa overlap). Conserved hypothetical protein, similar to others e.g. AL049587|SC5F2A_30S|T35272 hypothetical protein from Streptomyces coelicolor (211 aa), FASTA scores: opt: 531,E(): 3.4e-29, (49.5% identity in 182 aa overlap); NP_420588.1|NC_002696 ThiJ/PfpI family protein from Caulobacter crescentus (267 aa); etc. Some similarity to Escherichia coli G1100872|thiJ (198 aa), FASTA scores: opt: 178, E(): 6.1e-06, (29.9% identity in 137 aa overlap). Also similar to Rv1930c from Mycobacterium tuberculosis (174 aa). May be a membrane protein. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 57400 | 57963 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0053|Mb0053
MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGGIGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNSLGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPVDAGSLAKASPATHRLALEFYQHRL
Bibliography
No article yet recorded