Gene Mb0054
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s6 rpsf |
Comments | Mb0054, rpsF, len: 96 aa. Equivalent to Rv0053,len: 96 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 96 aa overlap). Probable 30S ribosomal protein S6, equivalent to RS6_MYCLE|P46389 30s ribosomal protein s6 from Mycobacterium leprae (96 aa), FASTA scores: opt: 570, E(): 1.1e-36, (91.7% identity in 96 aa overlap).Also highly similar to many e.g. Q9X8U2|RS6_STRCO 30S RIBOSOMAL PROTEIN S6 from Streptomyces coelicolor (96 aa); etc. Note that the putative product of this CDS corresponds to spot 6_26 identified in culture supernatant by proteomics at the Max-Planck-Institut fuer Infektionsbiologie (see citations below). Contains PS01048 Ribosomal protein S6 signature. BELONGS TO THE S6P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 58182 | 58472 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0054|rpsF MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH
Bibliography
No article yet recorded