Gene Mb0057
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l9 rpli |
| Comments | Mb0057, rplI, len: 152 aa. Equivalent to Rv0056,len: 152 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 152 aa overlap). Probable rplI, 50S ribosomal protein L9, equivalent to RL9_MYCLE|P46385 50s ribosomal protein l9 from Mycobacterium leprae (152 aa),FASTA scores: opt: 847, E(): 0, (88.7% identity in 150 aa overlap). Also highly similar to others e.g. Q9X8U5|RL9_STRCO 50S RIBOSOMAL PROTEIN L9 from Streptomyces coelicolor (148 aa); etc. Contains PS00651 Ribosomal protein L9 signature. BELONGS TO THE L9P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 59399 | 59857 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0057|rplI
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAIKKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS
Bibliography
No article yet recorded