Gene Mb0062A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Mb0062A, len: 112 aa. Equivalent to Rv0061c len: 112 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 112 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Conserved hypothetical protein supported by RNA-seq data. Similar to MMAR_3839, 76% identity in 112 aa overlap. Replaces questionable ORF Rv0061 (MTV030.04). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 65002 | 65340 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0062A|Mb0062A
MKLKFARLSTAILGCAAALVFPASVASADPPDPHQPDMTKGYCPGGRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEPLPGPPPPGGCGGAIPSEQPNAP
Bibliography
No article yet recorded