Gene Mb0066 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible toxin vapc1 | 
| Comments | Mb0066, -, len: 133 aa. Equivalent to Rv0065, len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Conserved hypothetical protein, similar to several hypothetical proteins from Mycobacterium tuberculosis: Rv0960 (127 aa),Rv1720c (129 aa), and Rv0549c (137 aa). | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 71848 | 72249 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0066|vapc1
MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
      
    Bibliography
    No article yet recorded