Gene Mb0079c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE OXIDOREDUCTASE |
| Comments | Mb0079c, -, len: 276 aa. Equivalent to Rv0077c,len: 276 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 276 aa overlap). Possible oxidoreductase (EC 1.-.-.-), weakly similar to others e.g. CAC44600.1|AL596162 putative oxidoreductase from Streptomyces coelicolor (275 aa); P33912|BPA1_STRAU NON-HAEM BROMOPEROXIDASE BPO-A1 (BROMIDE PEROXIDASE) (EC 1.11.1.-) from Streptomyces aureofaciens (275 aa); BPA1_STRAU|P33912 non-haem bromoperoxidase bpo-a1 from Streptomyces aureofaciens (274 aa), FASTA scores: opt: 230, E(): 1.5e-07, (26.1% identity in 249 aa overlap); etc. Also similar to MTCY05A6_35 and MTCY1A11_10 from Mycobacterium tuberculosis. And shows some similarity in part with AAL17935.1|AY054120 putative epoxide hydrolase from Mycobacterium smegmatis (203 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 85671 | 86501 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0079c|Mb0079c
MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLAGRGLRCIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTGGVVTQLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAAIQVMRAPAARNRAYAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSLRTEVTTAVAARLPEFDKPALIAWSADDVFFALENGQRLAATIPRARFEVIEGARTFSMVDSPDRLADQLSTVAVRT
Bibliography
No article yet recorded