Gene Mb0092
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE METHYLTRANSFERASE/METHYLASE |
| Comments | Mb0092, -, len: 197 aa. Equivalent to Rv0089, len: 197 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 197 aa overlap). Possible methyltransferase (EC 2.1.1.-), showing some weak similarity to others e.g. NP_299749.1|NC_002488 3-demethylubiquinone-9 3-methyltransferase from Xylella fastidiosa 9a5c (246 aa); CAC44277.1| (AL596030) putative methyltransferase from Streptomyces coelicolor (285 aa); NP_111415.1|NC_002689 Predicted SAM-dependent methyltransferase from Thermoplasma volcanium (245 aa); etc. Also some similarity with many biotin biosynthesis proteins e.g. P12999|BIOC_ECOLI|B0777 BIOTIN SYNTHESIS PROTEIN from Escherichia coli (251 aa), FASTA scores: opt: 202, E(): 4.5e-07, (39.0% identity in 118 aa overlap); etc. BELONGS TO THE METHYLTRANSFERASE SUPERFAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 97793 | 98386 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0092|Mb0092
MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIPYVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTALSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQTLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV
Bibliography
No article yet recorded
