Gene Mb0101
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable fatty acyl coa thioesterase type iii fcot |
| Comments | Mb0101, -, len: 183 aa. Equivalent to Rv0098, len: 183 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 183 aa overlap). Conserved hypothetical protein, equivalent to CAC30948.1|AL583924 conserved hypothetical protein from Mycobacterium leprae (183 aa). Also some similarity with BAB69378.1|AB070955 hypothetical protein from Streptomyces avermitilis (172 aa). |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 107636 | 108187 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0101|fcot
MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEFWDENGGAASGEIELAALNIP
Bibliography
No article yet recorded