Gene Mb0108c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l28-1 rpmb1 |
Comments | Mb0108c, rpmB1, len: 94 aa. Equivalent to Rv0105c,len: 94 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 94 aa overlap). Probable rpmB1, 50S ribosomal protein L28-1, highly similar to others e.g. Q9X8K8|R28B_STRCO 50S RIBOSOMAL PROTEIN L28-2 from Streptomyces coelicolor (78 aa); RL28_ECOLI|P02428 50s ribosomal protein l28 from Escherichia coli (77 aa), FASTA scores: opt: 167, E(): 6.2e-06, (40.7% identity in 59 aa overlap); etc. Also similar to MTCY63A_2 from Mycobacterium tuberculosis. BELONGS TO THE L28P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 124016 | 124300 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0108c|rpmB1 MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL
Bibliography
No article yet recorded