Gene Mb0118
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible d-alpha,beta-d-heptose-1,7-biphosphate phosphatase gmhb (d-glycero-d-manno-heptose 7-phosphate kinase) |
| Comments | Mb0118, -, len: 190 aa. Equivalent to Rv0114, len: 190 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 190 aa overlap). Possible dehydratase (EC 4.-.-.-), similar to several hypothetical proteins and to HIS7_ECOLI|P06987 imidazoleglycerol-phosphate dehydratase (355 aa), FASTA scores: opt: 250, E(): 3.6e-11, (34.0 % identity in 141 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 137979 | 138551 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0118|gmhb
MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARALKKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQRCGCRKPRPGLVLDWLRRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGASSGGVADASFDSLWEFAVAVGHARGERG
Bibliography
No article yet recorded