Gene Mb0126c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0126c, -, len: 144 aa. Equivalent to Rv0121c,len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 144 aa overlap). Conserved hypothetical protein, showing some similarity with others proteins from Mycobacterium tuberculosis e.g. Rv1155,Rv1875, Rv2074, etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 147946 | 148380 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0126c|Mb0126c
MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEATGADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRDGEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA
Bibliography
No article yet recorded