Gene Mb0145
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0145, -, len: 126 aa. Equivalent to Rv0140, len: 126 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 126 aa overlap). Conserved hypothetical protein, similar to others e.g. P74567|D90916_48 HYPOTHETICAL 20.8 KDP ROTEIN from Synechocystis sp. (180 aa), FASTA scores: opt: 229, E(): 4.7e-10, (36.1% identity in 108 aa overlap). Also similar to Rv1056 and Rv1670 from Mycobacterium tuberculosis. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 167100 | 167480 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0145|Mb0145
MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEASYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPAVAAIAGHVACYPDKAEISIFPG
Bibliography
No article yet recorded