Gene Mb0169
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein tb18.5 |
Comments | Mb0169, TB18.5, len: 161 aa. Equivalent to Rv0164,len: 161 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 161 aa overlap). TB18.5, conserved hypothetical protein, equivalent to CAB08818.1|Z95398 HYPOTHETICAL PROTEIN from Mycobacterium leprae (156 aa) FASTA scores: opt: 762, E(): 0, (76.3% identity in 152 aa overlap). Some similarity to Rv2185c, Rv0854, Rv0857 from Mycobacterium tuberculosis. Alternative start codon has been suggested. 3' part corrected since first submission (-24 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 193816 | 194301 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0169|TB18.5 MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEWNEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQEQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS
Bibliography
No article yet recorded