Gene Mb0169 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein tb18.5 | 
| Comments | Mb0169, TB18.5, len: 161 aa. Equivalent to Rv0164,len: 161 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 161 aa overlap). TB18.5, conserved hypothetical protein, equivalent to CAB08818.1|Z95398 HYPOTHETICAL PROTEIN from Mycobacterium leprae (156 aa) FASTA scores: opt: 762, E(): 0, (76.3% identity in 152 aa overlap). Some similarity to Rv2185c, Rv0854, Rv0857 from Mycobacterium tuberculosis. Alternative start codon has been suggested. 3' part corrected since first submission (-24 aa). | 
| Functional category | |
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 193816 | 194301 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0169|TB18.5
MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEWNEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQEQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS
      
    Bibliography
    No article yet recorded