Gene Mb0196
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0196, -, len: 96 aa. Equivalent to Rv0190, len: 96 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 96 aa overlap). Conserved hypothetical protein, highly similar to several hypothetical proteins e.g. SYCSLRA_35|Q55554|SLL0176 hypothetical 18.9 KD protein from Synechocystis (167 aa), FASTA scores: opt: 237, E(): 5.8e-16, (39.4% identity in 94 aa overlap). Also highly similar to Z95398|MLCL622_7|O06070 from Mycobacterium leprae (135 aa), FASTA score: (82.6% identity in 92 aa overlap). Also similar to hypothetical proteins from Mycobacterium tuberculosis e.g. Rv0967,Rv0030, Rv1766 (42.5% identity in 80 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 222063 | 222353 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0196|Mb0196
MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQISAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS
Bibliography
No article yet recorded