Gene Mb0247c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable 3-hydroxyacyl-thioester dehydratase htdx |
| Comments | Mb0247c, -, len: 280 aa. Equivalent to Rv0241c,len: 280 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 280 aa overlap). Conserved hypothetical protein, highly similar to MLCB1883.17c|T44876063881|CAA18566.1|AL022486 hypothetical protein from Mycobacterium leprae (280 aa), FASTA scores: opt: 1564, E(): 0, (81.8% identity in 280 aa overlap); and CAC32097.1|AL583926 conserved hypothetical protein from Mycobacterium leprae (300 aa). Also similar to proteins from other organisms e.g. CAB77291.1|AL160312 putative dehydratase from Streptomyces coelicolor (291 aa); part of BAA92930.1|AB032743 fatty acid synthetase beta subunit from Pichia angusta (2060 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 288136 | 288978 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0247c|htdx
MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVAAYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVTDAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQKKPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLANIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL
Bibliography
No article yet recorded
