Gene Mb0280
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0280, -, len: 193 aa. Equivalent to Rv0274, len: 193 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 193 aa overlap). Conserved hypothetical protein, highly similar to AAK25058.1|AE005973 conserved hypothetical protein from Caulobacter crescentus (174 aa). Shows also some similarity to others hypothetical proteins e.g. AJ002571|BSAJ2571_7 from Bacillus subtilis (316 aa), FASTA scores: opt: 138, E(): 0.033, (27.1% identity in 133 aa overlap). Previous hits with Q56415|M85195 FOSFOMYCIN-RESISTANCE PROTEIN from SERRATIA MARCESCENS (141 aa), FASTA scores: opt: 82, E(): 1.1e -08, (29.1% identity in 151 aa overlap). Contains PS00082 Extradiol ring-cleavage dioxygenases signature near C-terminus. TBparse score is 0.914. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 328747 | 329328 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0280|Mb0280
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR
Bibliography
No article yet recorded