Gene Mb0283c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc25. contains pin domain. |
| Comments | Mb0283c, -, len: 142 aa. Equivalent to Rv0277c,len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Conserved hypothetical protein, highly similar to Rv0749|H70824|2911023|CAA17516.1|AL021958 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (142 aa); and similar to several other hypothetical Mycobacterium tuberculosis proteins: Rv0277c, Rv2530c,etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 331033 | 331461 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0283c|vapc25
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI
Bibliography
No article yet recorded