Gene Mb0293
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe family protein pe5 |
Comments | Mb0293, PE5, len: 102 aa. Equivalent to Rv0285,len: 102 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 102 aa overlap). Member of the Mycobacterium tuberculosis PE family (see first citation below), similar to others e.g. AL0212|MTV012_37 from Mycobacterium tuberculosis (105 aa), FASTA scores: opt: 497, E(): 2.6e-24, (80.4% identity in 102 aa overlap); Z80108|MTCY21B4.03 from Mycobacterium tuberculosis (102 aa), FASTA scores: opt: 413, E(): 3.7e-19, (66.7% identity in 102 aa overlap); etc. |
Functional category | Pe/ppe |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 350626 | 350934 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0293|PE5 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
Bibliography
No article yet recorded