Gene Mb0297
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-3 secretion-associated protein espg3 |
| Comments | Mb0297, -, len: 295 aa. Equivalent to Rv0289, len: 295 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 295 aa overlap). Conserved hypothetical protein, equivalent to CAC32061.1|AL583926 possible DNA-binding protein from Mycobacterium leprae (289 aa); and showing some similarity to Rv3866|G70656|CAB06238.1|Z94121|MTCY15F10.23 from Mycobacterium tuberculosis (276 aa), FASTA scores: opt: 149, E(): 0.0035, (27.7% identity in 289 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 353151 | 354038 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0297|espg3
MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS
Bibliography
No article yet recorded