Gene Mb0309
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc2 |
| Comments | Mb0309, -, len: 141 aa. Equivalent to Rv0301, len: 141 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 141 aa overlap). Conserved hypothetical protein, similar to other hypothetical M. tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 365091 | 365516 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0309|vapc2
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Bibliography
No article yet recorded