Gene Mb0318c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0318c, -, len: 163 aa. Equivalent to Rv0310c,len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 163 aa overlap). Conserved hypothetical protein, similar to some bile acid dehydratases e.g. P19412|BAIE_EUBSP|98749|D37844|1381566|AAC45413.1|U57489 BILE ACID-INDUCIBLE OPERON PROTEIN E from Eubacterium sp (166 aa), FASTA scores: opt: 302, E(): 1e-11, (38.8% identity in 134 aa overlap); AAF22847.1|AF210152_4 bile acid 7a-dehydratase from Clostridium sp. (168 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 379687 | 380178 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0318c|Mb0318c
MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDVTGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDRVIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
Bibliography
No article yet recorded