Gene Mb0321
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0321, -, len: 128 aa. Equivalent to Rv0313, len: 128 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 128 aa overlap). Conserved hypothetical protein, equivalent only to CAC32049.1|AL583926 conserved hypothetical protein from Mycobacterium leprae (130 aa). TBparse score is 0.877. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 383520 | 383906 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0321|Mb0321
MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGWSAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDPKRKVRFLPYGIAVSVLDDPVDEAQ
Bibliography
No article yet recorded