Gene Mb0361
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable heat shock protein transcriptional repressor hspr (merr family) |
Comments | Mb0361, hspR, len: 126 aa. Equivalent to Rv0353,len: 126 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 126 aa overlap). Probable hspR, heat shock regulatory protein, merR family, highly similar to others e.g. HspR|P40183 heat shock regulatory protein from Streptomyces coelicolor (151 aa), FASTA scores: E(): 4.9e-22, (55.7% identity in 140 aa overlap), that binds to three inverted repeats (IR1-IR3) in the promoter region of the dnaK operon. Has possible coiled coil region in C-terminal half. BELONGS TO THE MERR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 424668 | 425048 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0361|hspR MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRANQRREVAVVPKSTALVVWKPRR
Bibliography
No article yet recorded