Gene Mb0363c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0363c, -, len: 214 aa. Equivalent to Rv0356c,len: 214 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 214 aa overlap). Conserved hypothetical protein, equivalent to AL023514|MLCB4_12 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium leprae (218 aa), FASTA scores: opt: 1067, E(): 0, (73.4% identity in 214 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 435847 | 436491 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0363c|Mb0363c
MTDASVHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQDLAVAADPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTRYGTDGVEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRRITPIDVPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP
Bibliography
No article yet recorded