Gene Mb0367c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0367c, -, len: 145 aa. Equivalent to Rv0360c,len: 145 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 145 aa overlap). Conserved hypothetical protein, equivalent to AL023514|MLCB4_16|CAA18948.1|AL023514|MLCB4.27c hypothetical protein from Mycobacterium leprae (137 aa),FASTA scores: opt: 793, E(): 0, (85.4% identity in 137 aa overlap). And similar to AL049754|SCH10_25c|T36537 hypothetical protein from Streptomyces coelicolor (143 aa), FASTA scores: opt: 497, E(): 3.2e-27, (55.8% identity in 138 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 439319 | 439756 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0367c|Mb0367c
MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAAHPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRGFLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL
Bibliography
No article yet recorded