Gene Mb0396
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0396, -, len: 140 aa. Equivalent to Rv0390, len: 140 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 140 aa overlap). Conserved hypothetical protein, equivalent to AL023514|MLCB4_11|CAA18942.1|AL023514 hypothetical protein from Mycobacterium leprae (147 aa), FASTA scores: opt: 778, E(): 0, (79.0% identity in 138 aa overlap). Also similar to hypothetical proteins from several Rickettsia species. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 470610 | 471032 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0396|Mb0396
MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLGREVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG
Bibliography
No article yet recorded