Gene Mb0422c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | thiamine-phosphate pyrophosphorylase thie (tmp pyrophosphorylase) (tmp-ppase) (thiamine-phosphate synthase) |
| Comments | Mb0422c, thiE, len: 222 aa. Equivalent to Rv0414c,len: 222 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 222 aa overlap). Probable thiE,thiamin phosphate pyrophosphorylase (EC 2.5.1.3),equivalent to Q9ZBL5|AL035159|MLCB1450_17 PROBABLE THIAMINE-PHOSPHATE PYROPHOSPHORYLASE from Mycobacterium leprae (235 aa), FASTA scores: opt: 1095, E(): 0, (78.0% identity in 223 aa overlap). Also similar to others e.g. T34974|5689976|CAB52013.1|AL109663 probable thiamin phosphate pyrophosphorylase from Streptomyces coelicolor (223 aa); THIE_ECOLI|P30137 thie protein from Escherichia coli strain K12 (211 aa), FASTA scores: opt: 275, E(): 7.8e-12, (37.8% identity in 196 aa overlap); etc. BELONGS TO THE TMP-PPASE FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 501369 | 502037 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0422c|thiE
MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
Bibliography
No article yet recorded
