Gene Mb0450c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ppe family protein ppe10 |
| Comments | Mb0450c, PPE10, len: 479 aa. Equivalent to Rv0442c,len: 487 aa, from Mycobacterium tuberculosis strain H37Rv,(99.8% identity in 479 aa overlap). Member of the Mycobacterium tuberculosis PPE family, nearly identical to hypothetical protein from Mycobacterium tuberculosis (strain Erdman) and to AN5S46909_1 protein fragment from Mycobacterium bovis (302 aa); P42611|YHS6_MYCTU HYPOTHETICAL 50.6 KD PROTEIN (517 aa), FASTA scores: opt: 3144, E(): 0, (98.4 identity in 492 aa overlap); and S46909|S46909_1 (302 aa), FASTA scores: opt: 1897, E(): 0,(98.0% identity in 302 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis,truncation at the 5' start due to a single base transition (g-a), leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (479 aa versus 487 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 531770 | 533209 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0450c|PPE10
MPPEINSALMFAGPGSGPLIAAATAWGELAEELLASIASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAALAATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASAAVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGSGNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGNVGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGSEAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAPVGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGSGIPKSNFYPSPDRESAYASPRIGQPVGSE
Bibliography
No article yet recorded
