Gene Mb0451
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0451, -, len: 171 aa. Equivalent to Rv0443, len: 171 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 171 aa overlap). Conserved hypothetical protein, highly similar to AL049863|SC5H1_23|T35339 hypothetical protein from Streptomyces coelicolor (171 aa), FASTA scores: opt: 561,E(): 2.3e-32, (49.7% identity in 165 aa overlap); and CAC42482.1|AJ318385 hypothetical protein from Amycolatopsis mediterranei (163 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 533415 | 533930 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0451|Mb0451
MASTDAAAQELLRDAFTRLIEHVDELTDGLTDQLACYRPTPSANSIAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTGYGHRPEDVAKVRAPADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARLVSIVDDCAQHLGQAAYLRGIAR
Bibliography
No article yet recorded