Gene Mb0463c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0463c, -, len: 148 aa. Equivalent to Rv0455c,len: 148 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 148 aa overlap). Conserved hypothetical protein, equivalent to CAC31896.1|AL583925 possible secreted protein from Mycobacterium leprae (153 aa). Has hydrophobic stretch at N-terminus. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 546394 | 546840 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0463c|Mb0463c
MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIATTCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFYNGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA
Bibliography
No article yet recorded