Gene Mb0512
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb0512, -, len: 78 aa. Equivalent to Rv0500A, len: 78 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 78 aa overlap). Conserved hypothetical protein, similar to proteins from Mycobacterium leprae and Streptomyces coelicolor e.g. U00018_25 from Mycobacterium leprae cosmid B2168 (86 aa), FASTA scores: opt: 428, E(): 1.3e-27, (82.6% identity in 86 aa overlap); AL079345|SCE68_26 from Streptomyces coelicolor cosmid E6 (70 aa), FASTA scores: opt: 252, E(): 1.2 e-13, (72.2 identity in 54 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 592262 | 592498 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0512|Mb0512 MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG
Bibliography
No article yet recorded