Gene Mb0516c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb0516c, -, len: 166 aa. Equivalent to Rv0504c,len: 166 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 166 aa overlap). Conserved hypothetical protein, equivalent to P54879|Y504_MYCLE|ML2425 HYPOTHETICAL 18.7 KDA PROTEIN from Mycobacterium leprae (166 aa), FASTA scores: opt: 884, E(): 0, (83.1% identity in 166 aa overlap); and highly similar to other proteins from Mycobacterium leprae. Also highly similar to CAB77410.1|AL160431|SCD82.07 hypothetical protein from Streptomyces coelicolor (150 aa). Also similar to M. tuberculosis hypothetical proteins Rv0635|H70612 (158 aa); and Rv0637|B70613 (166 aa). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 595953 | 596453 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0516c|Mb0516c MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSEPDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILANDKLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAIASI
Bibliography
No article yet recorded