Gene Mb0538
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0538, -, len: 202 aa. Equivalent to Rv0525, len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 202 aa overlap). Conserved hypothetical protein, equivalent to Q49821|B2168_C3_276|S72912 hypothetical protein from Mycobacterium leprae (202 aa), FASTA scores: opt: 1151,E(): 0, (82.5% identity in 200 aa overlap). Also highly similar to CAC08377.1|AL392176 putative phosphoglycerate mutase from Streptomyces coelicolor (233 aa); and similar to SLL0395|Q55734 hypothetical 23.8 kDa protein from SYNECHOCYSTIS SP. (212 aa), FASTA scores: opt: 207, E(): 5.1e-07, (28.2% identity in 195 aa overlap). Also some similarity to Rv2228c|Y019_MYCTU|Q10512|cy427.09 hypothetical 39.2 kd protein from Mycobacterium tuberculosis (364 aa), FASTA scores: opt: 236, E(): 1.1e-08, (34.3% identity in 198 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 617373 | 617981 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0538|Mb0538
MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADALADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRDPRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLTGKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL
Bibliography
No article yet recorded