Gene Mb0560c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0560c, -, len: 128 aa. Equivalent to Rv0546c,len: 128 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 128 aa overlap). Conserved hypothetical protein, equivalent to AAA63111.1|U15187|Q50174|U296X hypothetical protein from Mycobacterium leprae (144 aa), FASTA scores: opt: 748,E(): 0, (84.2% identity in 133 aa overlap). Also highly similar to CAB95979.1|AL360034 conserved hypothetical protein from Streptomyces coelicolor (130 aa); and similar to AE000854_8|O26852 S-D-LACTOYLGLUTATHIONE METHYLGLYOXAL LYASE from Methanobacterium thermoautotropto (116 aa),FASTA scores: opt: 155, E(): 0.00019, (30.6% identity in 108 aa overlap); YAER_ECOLI hypothetical 14.7 kd protein from Escherichia coli (129 aa), FASTA scores: opt: 104,E(): 0.42, (28.7% identity in 115 aa overlap). Also similar to Rv2068c from Mycobacterium tuberculosis. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 638827 | 639213 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0560c|Mb0560c
MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQSLLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVTDPDGITLIFVEVPEGHPLRTDTRA
Bibliography
No article yet recorded
