Gene Mb0562c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | naphthoate synthase menb (dihydroxynaphthoic acid synthetase) (dhna synthetase) |
| Comments | Mb0562c, menB, len: 314 aa. Equivalent to Rv0548c,len: 314 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 314 aa overlap). Probable menB,naphthoate synthase (dihydroxynaphthonic acid synthase) (EC 4.1.3.36), equivalent to NP_302473.1|NC_002677 naphthoate synthase from Mycobacterium leprae (300 aa). Also similar to others e.g. MENB_ECOLI|P27290 naphthoate synthase from Escherichia coli (285 aa), FASTA scores: opt: 599, E(): 9.3e-33, (48.1 identity in 285 aa overlap); etc. BELONGS TO THE ENOYL-COA HYDRATASE/ISOMERASE FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 640256 | 641200 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0562c|menB
MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF
Bibliography
No article yet recorded