Gene Mb0581c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0581c, -, len: 163 aa. Equivalent to Rv0566c,len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 163 aa overlap). Conserved hypothetical protein, similar to others e.g. P77482|YAJQ_ECOLI HYPOTHETICAL 19.0 KDa PROTEIN from Escherichia coli (169 aa), FASTA scores: opt: 422, E(): 5.4e-20, (44.1 identity in 161 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 658791 | 659282 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0581c|Mb0581c
MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKGDEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISSENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR
Bibliography
No article yet recorded